Artificial Intelligence for Decision Making Initiative 2022 (2024)

The Artificial Intelligence for Decision Making Initiative 2022 (the Initiative) is now accepting applications.

The Initiative is a collaborative project between the Office of National Intelligence (ONI) and the Defence Science and Technology Group (DSTG), to develop Artificial Intelligence (AI) and Machine Learning (ML) expertise and capability in areas of significant importance to the Australian defence and national security community.

Individuals are invited to apply their skill and expertise to solve one of 30 AI and ML research and development related challenges.

Successful applicants will be provided with a fixed value of $30,000 per project and could also be part of a national network focused on developing AI and ML technology, through the Defence AI Research Network (DAIRNet). There may also be the opportunity for project prototypes to be considered for progression through the Defence Artificial Intelligence Centre (DAIC), or Defence and university sectors. However, there is no guarantee that successful applicants will receive further funding support.

The Initiative is being delivered on a national basis through the Defence Science Centre, Defence Science Institute, Defence Innovation Network and Defence Innovation Partnership and managed on behalf of DSTG by DAIRNet.

There are 30 Challenge topics listed here:

  • Download the 30 Challenge topics document

Project Requirements

Funded projects will demonstrate prototype solutions, in the form of a software tool or related product that demonstrates the solution(s) to the chosen Challenge.

Applicants must also provide project reports that detail the approach to the Challenge and an overview of the solution to enable assessment of project performance.

The funding amount is a fixed value of $30,000 per project.

The length of projects must be three months.

The intent of the Initiative is to fund individuals to undertake separate projects. However, small team-based proposals may be considered, subject to available funding. Funding for a team-based proposal is restricted to the same arrangements for an individual.

Individuals may submit applications to as many Challenges as they wish. However, each project must be discrete and stand-alone from others.

Conditions of Funding

Funds can be used for direct costs associated with the project, including salary and salary oncosts. Due to the small funding amount and desire to support capability the funds cannot be used for the recovery of indirect overheads.

Only personnel listed on the application can be involved in the project or supported by the funds.

Eligibility

Applications will be accepted from small teams or individuals who meet eligibility requirements.

The Initiative is open to Australian citizens or permanent residents who reside in Australia and are currently employed by an Australian-based company, university or research organisation that holds an Australian Business Number (ABN).

There may be a requirement for identification, proof of citizenship/permanent residency, police and other background checks prior to the commencement of the project.

Project Outcomes and Deliverables

The aim of the Initiative is to fund short pilots to identify and propose novel, prototype and nascent solutions and approaches to the designated Challenges and this will be discussed with successful applications.

There will be two milestones due, one at the end of May and the other at the end of June, and corresponding invoicing will be as per the standard contract terms.

Criteria

The following criteria will be used to assess proposals:

1. Relevance and alignment to the research problem (40%)
2. Novelty, quality and feasibility of the approach (40%)
3. Expertise in relevant technical field (20%)

Intellectual Property

Ownership of intellectual property developed using the funds will be retained by the successful applicants. All successful applicants will be required to grant a licence to the Commonwealth to use project intellectual property for Commonwealth purposes via an IP Licence Deed.

Submitting your Application

Applications will only be accepted via the Initiative's Application Portal. Applications will be assessed by a Panel, and it is expected up to 50 projects could be funded.

Opening and Closing Timeframes

Applicationsare now closed.

Contract arrangements

This program is funded by the Department of Defence and successful recipients will be required to enter into a research agreement with the Commonwealth. This initiative is based on the use of standardised research agreements (DSP Schedule 3 – Research Agreement for universities and the DSTG Research Agreement for industry) and the terms and conditions of which are not open to negotiation. Please ensure your organisation agrees to these conditions before submitting your proposal.

Applicants are encouraged to engage with their local, State-based Australian Defence Science and University Network (ADSUN) members, who can assist with the development of the applications.

The ADSUN members for each State are as listed below.

Applicant LocationADSUN MemberEmail
WADefence Science Centre (DSC)QFP@wgfv.jn.tbi.nh
VIC & TASDefence Science Institute (DSI)nv@qrsraprfpvraprvafgvghgr.pbz
NSW & ACTDefence Innovation Network (DIN)vasb@qrsraprvaabingvbaargjbex.pbz
QLDQueensland Defence Science Alliance (QDSA)vasb@dhrrafynaqqrsraprfpvraprnyyvnapr.pbz.nh
SA & NTDefence Innovation Partnership (DIP)radhvevrf@qrsraprvaabingvbacnegarefuvc.pbz

Getting help

Refer to our Frequently Asked Questions attached.

If you require other assistance or guidance to complete the application form, please contact DAIRNet.

Artificial Intelligence for Decision Making Initiative 2022 (2024)

FAQs

What is the artificial intelligence for decision-making initiative 2022? ›

The Artificial Intelligence for Decision Making Initiative 2022 is a collaborative project between the Office of National Intelligence and the Defence Science and Technology Group, and is supported by the Defence Science Centre.

How does artificial intelligence help in decision-making? ›

AI automated decision making allows businesses or companies to make faster, accurate, and consistent decisions by capitalizing on datasets with AI. Artificial intelligence can analyze large datasets without error. This helps business teams to focus better on work relevant to their field.

Can we trust AI decision-making? ›

Humans are largely predictable to other humans because we share the same human experience, but this doesn't extend to artificial intelligence, even though humans created it. If trustworthiness has inherently predictable and normative elements, AI fundamentally lacks the qualities that would make it worthy of trust.

Can AI replace decision-making? ›

Can AI systems make decisions without human intervention? While AI systems can process vast amounts of data and make decisions quickly, they lack human judgment, ethics, and adaptability, which can lead to errors, biases, and negative consequences.

Is AI good or bad? ›

Conclusion: AI is neither inherently good nor bad. It is a tool that can be used for both beneficial and harmful purposes, depending on how it is developed and used. It is important to approach AI with caution and responsibility, ensuring that it is developed and used in an ethical and transparent manner.

What is an example of AI smart decision-making? ›

By automating these processes, AI can make decisions more quickly and accurately than humans. For example, airlines can use AI to continuously optimize ticket prices by analyzing real-time factors such as demand and competition, leading to more efficient pricing decisions.

Can AI make decisions on its own? ›

For example, 'can AI make decisions taking empathy into account'? AI models are designed to help with decision making when humans cannot handle all the data, variables and parameters involved in managing a situation. However, when intangible human emotions are involved, AI still flounders.

Is AI better at decision-making than humans? ›

Results showed that AI alone performed worse than the judge in predicting reoffenders — in this case, by imposing the tighter restriction of cash bail. At the same time, little to no difference was found between the accuracy of human-alone and AI-assisted decision-making.

Is Bill Gates worried about AI? ›

Gates also expressed concerns and risks associated with bad actors getting their hands on AI, while Altman noted that AI will impact the "geopolitical balance of power."

Will AI be a danger to humanity? ›

How AI could backfire on humans. A related document published by Gladstone AI warns that the development of AGI and capabilities approaching AGI “would introduce catastrophic risks unlike any the United States has ever faced,” amounting to “WMD-like risks” if and when they are weaponized.

Will AI outsmart humans? ›

Elon Musk predicts AI will outsmart humans by the end of 2026 — earlier than he first expected. He said in an X interview that the "world's smartest people" are entering AI as the sector booms. But data scarcity, a GPU shortage, and electricity demands pose some obstacles to AI development.

What is the future of AI decision-making? ›

The future of decision-making lies in the effective application of Decision Intelligence. By embracing this approach, businesses can unlock new levels of efficiency, innovation, and growth, paving the way for a more informed, agile, and prosperous future.

How to use AI for decision-making? ›

AI technologies, such as cognitive computing and machine learning, can facilitate decision-making processing by analyzing vast amounts of data, recognizing patterns, and recommending optimal solutions. This can help decision makers in complex scenarios, such as medical diagnosis or strategic planning.

How is AI used in government decision-making? ›

What is the role of AI in government decision-making? AI plays a crucial role in government decision-making by analyzing large amounts of data, identifying patterns and trends, and providing insights to inform policy choices.

What is AI initiative? ›

The laboratory's AI Initiative is dedicated to ensuring secure, trustworthy, and energy efficient AI in the service of scientific research and national security.

Top Articles
Level 1: Definition, How Trading Screen Works, and Accessibility
Needs assessment | Carers UK
Bad Moms 123Movies
What Will It Take for Spotify’s Joe Rogan Deal to Pay Off?
Melissababyxo Cam
Lkq Pull-A-Part
Chris Wragge Illness
Who is on the FBI Most Wanted list cryptocurrency?
Bg3 Fake Portrait Of A Noble Before His Death
Audrey Boustani Age
Sara Carter Fox News Photos
Aces Charting Ehr
Tamara Lapman
Foodsmart Jonesboro Ar Weekly Ad
UHD-4K-Monitor mit 27 Zoll und VESA DisplayHDR™ 400 - 27UQ750-W | LG DE
Dusk Hypixel Skyblock
Megan Thee Stallion, Torrey Craig Seemingly Confirm Relationship With First Public Outing
Franklin City School District - Ohio
Chittenden County Family Court Schedule
Chicken Coop Brookhaven Ms
Sour Animal Strain Leafly
Juego Friv Poki
Sinfuldeeds Pt 2
Highplainsobserverperryton
Spinning Gold Showtimes Near Mjr Westland Grand Cinema 16
-apostila-de-ingles-cn-epcar-eam-essa-eear-espcex-afa-efomm-en-e-ita-pr f3476c8ab0af975f02f2f651664c5f13 - Matemática
Redgifs.comn
Check Subdomains Of A Domain
Sams Gas Price Garland Tx
Go Karts For Sale Near Me Under $500
Kraken Strategy Osrs
Foley Housing Authority Photos
San Diego Cars And Trucks Craigslist
Better Health Solutions Bridal Package
Woude's Bay Bar Photos
Junees Cedarhurst
Envision Okta Sign In
Vance Outdoors | Online Shopping for Firearms, Ammunition and Shooting Accessories
Corinne Massiah Bikini
Dr Roger Rosenstock Delray Beach
How Old Is Ted Williams Fox News Contributor
The Little Mermaid (2023) | Rotten Tomatoes
'We weren't done': Spacebar Arcade closes its doors for good
Ncaa Wrestling Bracket Challenge
Us 25 Yard Sale Map
Katmovie.hs
Footfetish Telegram
Math Nation Algebra 2 Practice Book Answer Key
Craigslist Antelope Valley General For Sale
29+ Des Moines Craigslist Furniture
Bòlèt New York Soir
Clarakitty 2022
Latest Posts
Article information

Author: Prof. An Powlowski

Last Updated:

Views: 6242

Rating: 4.3 / 5 (64 voted)

Reviews: 87% of readers found this page helpful

Author information

Name: Prof. An Powlowski

Birthday: 1992-09-29

Address: Apt. 994 8891 Orval Hill, Brittnyburgh, AZ 41023-0398

Phone: +26417467956738

Job: District Marketing Strategist

Hobby: Embroidery, Bodybuilding, Motor sports, Amateur radio, Wood carving, Whittling, Air sports

Introduction: My name is Prof. An Powlowski, I am a charming, helpful, attractive, good, graceful, thoughtful, vast person who loves writing and wants to share my knowledge and understanding with you.